PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn153601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 122aa    MW: 13604.3 Da    PI: 3.7722
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn153601genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26059.78e-1986345100
      DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    +lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+aela++++e
  Achn153601   8 ASVELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAELAKTQAE 63 
                 556789**********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.468164IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-171061IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MLSQFVAASV ELPESQRADA VSSMVYEANA RIRDPVYGCA GAICQLQKQV SELQAELAKT  60
QAELLTMQCQ QNNLMALFCM EASQISQEPI FPQHQEDEQE QVLYDNAIFS LDDANWETLW  120
A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057811.13e-44PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK086e-30LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A061FNS01e-43A0A061FNS0_THECC; LOB domain-containing protein 1
TrEMBLK4DAV44e-44K4DAV4_SOLLC; Uncharacterized protein
STRINGSolyc11g072470.1.11e-43(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-31LOB domain-containing protein 11